PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8098_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 517aa    MW: 57690.1 Da    PI: 8.3227
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8098_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.62.7e-102222591954
                                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  cra_locus_8098_iso_1_len_1816_ver_3 222 FEHflHPYPKDSDKQMLAKQTGLTRSQVSNWFINARVR 259
                                          554459******************************88 PP

2BELL113.21.4e-3683154172
                                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                          ++qe+q+kkakL+s+l+eV++rY+qy+ q+q+v++sFe+++g gsa++Yt+lAl++iS++FrcLkdai  qi
  cra_locus_8098_iso_1_len_1816_ver_3  83 QKQEIQMKKAKLMSMLDEVEQRYRQYHYQMQIVVASFEQATGSGSARSYTQLALQTISKQFRCLKDAILAQI 154
                                          579*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.2E-5214152IPR006563POX domain
PfamPF075263.8E-4619150IPR006563POX domain
PROSITE profilePS5007112.455200263IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-29202277IPR009057Homeodomain-like
CDDcd000861.09E-11203264No hitNo description
SMARTSM003891.8E-10203267IPR001356Homeobox domain
SuperFamilySSF466892.91E-17204270IPR009057Homeodomain-like
PfamPF059209.0E-19220259IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
XNNNNNNNNI PSSSAQSHVV LGSKYLKAAQ QLLDELVCVG KGTIKSEKIH EKGKEKLEKA  60
DNKEASSNNI GETKASNELT TSQKQEIQMK KAKLMSMLDE VEQRYRQYHY QMQIVVASFE  120
QATGSGSARS YTQLALQTIS KQFRCLKDAI LAQIKAASKS LGEEEGFGSG GKVEGSSRLK  180
FVDQHIRQQR ALQHLGMMQN NAWRPQRGLP ERAVSVLRAW LFEHFLHPYP KDSDKQMLAK  240
QTGLTRSQVS NWFINARVRL WKPMVEEMYA EEMKNQEDDN SESNKDQMGS SKSTAPKDNK  300
TEKLNAIIQD EISNSSHHVT LSPNGCSQQQ ARAGFGLVCA LNMEGNAEKT PKKVRTHHEL  360
QNSPSSILSM DMEMKFGETR KGFGAFNLGD LGQFNPEQLT TGFHGNGVSL TLGLPPSENL  420
PLSARGSHQN FVSEQTMDLG NRMEMGTIEA HYDRIVNKPQ ASHGNNNMAY DQTINDFENR  480
KRFAAQLLPD FVTXSDNNIG GQGSEVEVKG ERENKIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-17209267563Homeobox protein Meis2
3k2a_B4e-17209267563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778869.11e-180PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778870.11e-180PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778871.11e-180PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478049.11e-180PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478051.11e-180PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478052.11e-180PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-118BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068V6M00.0A0A068V6M0_COFCA; Uncharacterized protein
STRINGVIT_06s0009g00410.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467